PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_011324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 382aa    MW: 42483.7 Da    PI: 8.0965
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_011324genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1277.6e-4089166178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +C v+gC++dls+++eyhrrh+vCe hsk+pvv+++g+eqrfCqqCsrfh+l efD+ krsCr+rL++hn+rrrk+q+
  DCAR_011324  89 TCLVDGCSSDLSKCREYHRRHRVCECHSKTPVVIIKGREQRFCQQCSRFHSLGEFDDVKRSCRKRLDGHNRRRRKPQQ 166
                  5**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.8E-3086151IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.35987164IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.55E-3788169IPR004333Transcription factor, SBP-box
PfamPF031102.0E-2990163IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDWVVKASAW DMAGLGEEDN SHFIALGGSS SLVGGKNGGG LLHDLGLGRL GDLQDGSMDI  60
IKERDGLKTL LLPLEMKKTH ALSCVKKVTC LVDGCSSDLS KCREYHRRHR VCECHSKTPV  120
VIIKGREQRF CQQCSRFHSL GEFDDVKRSC RKRLDGHNRR RRKPQQEALY MTSQNFLSDY  180
KGGGWLQFSS PQAYGSSTNI NSGISISWPA NNSNNNQRLH SSLKKAFNGT DKEFSFLTDT  240
NSRKGIYWNP EAAITQKVVN SEGTSASNCR NIIVSDKLTH LEESTCALSL LSTNQIQAAK  300
TIMNPSAYQH DAFHSSQPTG INLQFDEMYP YSYPRIMEDK PIRAGAISDG NNIFDCSING  360
ISQLCSNELY EQEHHNSFPC K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-26901631184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13339GGKNGGG
2146163KRSCRKRLDGHNRRRRKP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.19e-44SBP family protein